У нас вы можете посмотреть бесплатно xqc clips that cured me или скачать в максимальном доступном качестве, видео которое было загружено на ютуб. Для загрузки выберите вариант из формы ниже:
Если кнопки скачивания не
загрузились
НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если возникают проблемы со скачиванием видео, пожалуйста напишите в поддержку по адресу внизу
страницы.
Спасибо за использование сервиса ClipSaver.ru
xQc is officially juicing it. If you enjoyed this compilation, don't forget to like, subscribe & comment for more xQc content just like this! ********************************************************* The best protein and gymwear: https://tidd.ly/3C97dHW If you are the original owner of the content viewed in this video, please contact me at [email protected] Please find xQc's socials here: Twitch: / xqcow YouTube: https://www.youtube.com/channel/UCmDT... Twitter: / xqc Instagram: / xqcow1 Reddit: / Discord: / discord Merch: https://metathreads.com/collections/xqc You can also find my socials here: / bozzeh10 2nd Channel: / @xqcpepegaclips9610 Submit your clips or suggest your video titles here: https://forms.gle/323aLMFV2haoTTTJA Clip links in order as seen in the video: ********************************************************* 00:00 - / kawaiiabstemiousbasenjisaltbae 00:20 - / importantcovertfoxthething-vwqk7hgpqakpiwsm 00:34 - / saltydirtydovevohiyo-z5q4m3m5unseevbq 00:42 - / nimbledeterminedwolfsmoocherz-m34lksybbddq... 01:01 - / relievedoilyrabbittinyface-9dibdkxjoj-3qvqt 01:16 - / confidentpoliteyampartytime-cm8qvhoqcftesft6 01:27 - / brightoilyfishlitfam-yg34-uxwpnvz6p-l 02:15 - / piercingspineynigiribleedpurple-n-_298n_dw... 02:29 - / trustworthyobesedillbrokeback-nnrj5rhfofdds5 02:47 - / lightscrumptiouseggplantsobayed-27ui3goe1t... 03:05 - / nastyencouragingokapiblargnaut-mpvm9rrjf1i... 03:14 - / littleneighborlyyakinikukappa-2zxie_9okcs1... 03:37 - / fancyroughflamingobrokeback-mvjtmloksfcqtf4u 03:59 - / funnypeacefulbaconralpherz-gjlwlshqdfig1b1a 04:17 - / livelycoweringdiscfunrun-yecl-vwwco_n4rod 04:38 - / boringpatientmeerkatsoonerlater 04:49 - / boringfitspindletbtacoright-cxcc92-u4rrd0x8 05:01 - / interestingtenuoushippoohmydog-yn76z4vbetf... 05:22 - / littlepolitewheelpunchtrees-kqbernc5ifticaha 05:46 - / coldgentleburritopartytime-gkb3b-t7plst8anz 06:40 - / clumsydaintysharktrihard-s6zhiakm7btyxa44 06:50 - / frigidimpartialgirafferaccattack-qrkixmihr... 07:23 - / refinedkathishgaurdogface-ibtwajvwb4fvgjm3 07:40 - / arborealcrazytapirpanicvis-tlrjuanzoyot0ast 07:47 - / badzanychinchillam4xheh-dp0urvv47r8uxrvv 07:59 - / opengenerouspeanutfungineer-wnayc9a2vmnge-ay 08:33 (last clip) - / zealouscautiousfloofcopythis-bz8jtz9b0wv7ljjo ********************************************************* #Bozzeh xQcOW? xQc (Felix Lengyel) is the gaming golem on the Twitch.tv platform. The OW is short to Overwatch. He amasses a following of 7.8M+ on his twitch profile, and his viewership and interactions/impressions reach upto thousands, even millions across all of his social platforms. All his social links can be found in the links section to view xQc's profiles. xQc is the MEGALUL warlock we all know, my favorite label is EL GOBLINO, but other nicknames may be Mr.Cow, The Fart of Twitch, X, xQ Cow, PVC, QVC, HDTV, LMG, PVP etc...He also refers to himself as the gaming golem, warlord of the gaming scene. His early mark on Twitch was due to his popularity on Overwatch, he is a top500 tank main, but he also competed in the Overwatch League for Dallas Fuel and in the Overwatch World Cup with Canada. These days, xQc finds his rhythm by entertaining through variety of games, including Minecraft, Overwatch, Chess, Fortnite, Valorant, CSGO, Simulators, Horror Games just to name a few!